PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_009774-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 324aa    MW: 36859.6 Da    PI: 9.5207
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_009774-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding582.2e-181762147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l ++v+q+G+ +W++Ia++++ gR++k+c++rw++ 
    NNU_009774-RA 17 RGHWRPAEDEKLRQLVEQYGPQNWNSIAEKLQ-GRSGKSCRLRWFNQ 62
                     899*****************************.***********996 PP

2Myb_DNA-binding58.41.7e-1869113147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r ++++eE+e+l+ a++ +G++ W++Iar ++ gRt++ +k++w+ +
    NNU_009774-RA  69 RRPFSEEEEERLLAAHRVHGNK-WALIARLFP-GRTDNAVKNHWHVV 113
                      679*******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.1021263IPR017930Myb domain
SuperFamilySSF466891.31E-2915110IPR009057Homeodomain-like
SMARTSM007173.9E-151665IPR001005SANT/Myb domain
PfamPF002491.5E-171762IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-271870IPR009057Homeodomain-like
CDDcd001673.29E-142061No hitNo description
PROSITE profilePS5129427.86264118IPR017930Myb domain
SMARTSM007178.0E-1668116IPR001005SANT/Myb domain
PfamPF002492.3E-1569112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-2171117IPR009057Homeodomain-like
CDDcd001672.17E-780114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MEDSVSGGSD DGKNCPRGHW RPAEDEKLRQ LVEQYGPQNW NSIAEKLQGR SGKSCRLRWF  60
NQLDPRINRR PFSEEEEERL LAAHRVHGNK WALIARLFPG RTDNAVKNHW HVVMARKHRE  120
RSKLHGKRGF QDLLRNPSSS SSYNFLGKCS KSQAENQSKE FHFNSSGFLE FQSHGKDRLF  180
VASPSCSSHT WAFSGSTNTT GSQSIDIFHG GGRDYFSSSS HASDQSRYSY CTTNSSIYSG  240
CRSFSSAPVL HNYKRVIYNP HLNHKDHDEG FGSNRMIKSS ELVRFGDDLI TQKLRRNSEQ  300
EQGDDSIKHK DVPFIDFLGV GISS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-31171177107B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010260471.10.0PREDICTED: myb-related protein 3R-1-like
TrEMBLA0A067H7L11e-112A0A067H7L1_CITSI; Uncharacterized protein
STRINGVIT_18s0001g15260.t011e-107(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.12e-64myb domain protein 52